Free delivery on orders above $100!
  • Become a Member
Free delivery on orders above $100!
Freshease Freshease
Select category
  • Select category
  • Baby
    • Baby Formula
    • Baby Nappies & Wipes
  • Bakery
    • Bagels
    • Baguettes
    • Biscuits & Crackers
    • Bread
    • Brownies
    • Cakes
    • Cookies
    • Donuts
    • Savoury
    • Sweet Pastry
    • Sweet Rolls
  • Christmas
  • Dairy & Fridge
    • Cheese
    • Cream
    • Deli
    • Desserts
    • Dips
    • Eggs
    • Falafel
    • Flavoured Milk
    • Long Life Milk
    • Milk
    • Powder Milk
    • Probiotic Drinks
    • Sauce
    • Spreads
    • Tofu
    • Yoghurt
  • Drinks
    • Energy Drinks
    • Flavoured Drinks
    • Flavoured Milk
    • General Items
    • Iced Teas
    • Juice
    • Probiotic Drinks
    • Soft Drinks
    • Sports Drinks
    • Water
  • Fish & Seafood
    • Seafood
  • Flower
    • Bouquet
  • Freezer
    • Cakes
    • Desserts
    • Frozen Beef
    • Frozen Chicken
    • Frozen Fish
    • Frozen Fish & Seafood
    • Frozen Fruits
    • Frozen Meals
    • Frozen Pork
    • Frozen Vegetables
    • Ice Cream
  • Fruits & Veggies
    • Fruits
    • Vegetables
  • Gums Lollies & Mints
  • Health & Beauty
    • Baby Nappies & Wipes
    • Bath & Shower
    • Cleaning
    • Dental Care
    • Eye Care
    • Face Body & Hands
    • Family Planning
    • Feminine Hygiene Products
    • Hair Treatments
    • Hand Sanitizer
    • Health Instruments
    • Health Supplements
    • Personal Care
    • Protein Powder
    • Protein Supplements
  • Household
    • Air Freshener
    • Batteries
    • Cleaning
    • Dishwashing
    • General Items
    • Insect Killer
    • Kitchen
    • Laundry
    • Tableware
    • Tissue
    • Toilet
  • Meat
    • Beef
    • Chicken
    • Duck
    • Halal Meat
    • Lamb
    • Pork
    • Turkey
  • Organic
    • Baby Snakcs
    • Baking
    • Beef
    • Biscuits & Crackers
    • Cereals
    • Cheese
    • Chips
    • Drinks
    • Face Body & Hands
    • Frozen Fruits
    • Fruits
    • Health Food
    • Juice
    • Milk
    • Nuts & Bars
    • Oil
    • Pasta & Pasta Sauce
    • Protein Powder
    • Rice & Grains
    • Sauce
    • Snacks
    • Spreads
    • Sweeteners
    • Tea & Coffee
    • Vegetables
    • Vinegar
    • Waffles
    • Yoghurt
  • Pantry
    • Baking
    • Biscuits & Crackers
    • Canned Fish
    • Canned Fruits
    • Canned Meat
    • Canned Vegetables
    • Cereals
    • Chips
    • Chocolates
    • Condiments
    • Cooking
    • General Items
    • Herbs & Spices
    • Jarred Vegetables
    • Noodles & Soup
    • Nuts & Bars
    • Oil
    • Pasta & Pasta Sauce
    • Pickles
    • Protein Bars
    • Rice & Grains
    • Sauce
    • Snacks
    • Spices
    • Spreads
    • Stationery
    • Sweeteners
    • Tea & Coffee
    • Vinegar
    • Wraps
  • Pet
    • Cat Food
    • Dog Food
    • General Items
  • Ready to go meals
  • Snacks
    • Chips
  • South East Asian
    • Baking
    • Biscuits & Crackers
    • Cake
    • Condiments
    • Desserts
    • Drinks
    • Frozen Meals
    • Herbs & Spices
    • Oil
    • Pickles
    • Rice & Grains
    • Tea & Coffee
Login / Register
0 Wishlist
0 Compare
0 items / $0.00
Menu
Freshease Freshease
0 items / $0.00
Browse Categories
  • Baby
    • Baby Formula
    • Baby Nappies & Wipes
  • Bakery
    • Bagels
    • Baguettes
    • Biscuits & Crackers
    • Bread
    • Brownies
    • Cakes
    • Cookies
    • Donuts
    • Savoury
    • Sweet Pastry
    • Sweet Rolls
  • Dairy & Fridge
    • Cheese
    • Cream
    • Deli
    • Desserts
    • Dips
    • Eggs
    • Falafel
    • Flavoured Milk
    • Long Life Milk
    • Milk
    • Powder Milk
    • Probiotic Drinks
    • Sauce
    • Spreads
    • Tofu
    • Yoghurt
  • Drinks
    • Energy Drinks
    • Flavoured Drinks
    • Flavoured Milk
    • Iced Teas
    • Juice
    • Milk
    • Probiotic Drinks
    • Soft Drinks
    • Sports Drinks
    • Water
  • Fish & Seafood
    • Seafood
  • Flower
    • Bouquet
  • Freezer
    • Cakes
    • Desserts
    • Frozen Beef
    • Frozen Chicken
    • Frozen Fish & Seafood
    • Frozen Fruits
    • Frozen Meals
    • Frozen Pork
    • Frozen Vegetables
    • Ice Cream
  • Fruits & Veggies
    • Fruits
    • Vegetables
  • Health & Beauty
    • Baby Nappies & Wipes
    • Bath & Shower
    • Cleaning
    • Dental Care
    • Eye Care
    • Face Body & Hands
    • Family Planning
    • Feminine Hygiene Products
    • Hair Treatments
    • Hand Sanitizer
    • Health Instruments
    • Health Supplements
    • Personal Care
    • Protein Powder
    • Protein Supplements
  • Household
    • Air Freshener
    • Batteries
    • Cleaning
    • Dishwashing
    • Insect Killer
    • Kitchen
    • Laundry
    • Tableware
    • Tissue
    • Toilet
  • Gums Lollies & Mints
  • Organic
    • Baby Snakcs
    • Baking
    • Beef
    • Biscuits & Crackers
    • Cereals
    • Cheese
    • Chips
    • Drinks
    • Face Body & Hands
    • Frozen Fruits
    • Fruits
    • Health Food
    • Juice
    • Milk
    • Nuts & Bars
    • Oil
    • Pasta & Pasta Sauce
    • Protein Powder
    • Rice & Grains
    • Sauce
    • Snacks
    • Spreads
    • Sweeteners
    • Tea & Coffee
    • Vegetables
    • Vinegar
    • Waffles
    • Yoghurt
  • Pantry
    • Baking
    • Biscuits & Crackers
    • Canned Fish
    • Canned Fruits
    • Canned Meat
    • Canned Vegetables
    • Cereals
    • Chips
    • Chocolates
    • Condiments
    • Cooking
    • General Items
    • Herbs & Spices
    • Jarred Vegetables
    • Noodles & Soup
    • Nuts & Bars
    • Oil
    • Pasta & Pasta Sauce
    • Pickles
    • Protein Bars
    • Rice & Grains
    • Sauce
    • Snacks
    • Spices
    • Spreads
    • Sweeteners
    • Tea & Coffee
    • Vinegar
    • Wraps
  • Pet
    • Cat Food
    • Dog Food
    • General Items
  • Ready to go meals
  • South East Asian
    • Frozen Meals
    • Herbs & Spices
    • Oil
    • Rice & Grains
    • Tea & Coffee
  • Home
  • Shop
  • SPECIALSNEW
  • Contact Us
  • FAQs
Sold out
EARTHSALTLIFEFINEHIMALAYANPINKSALT2X750G
Click to enlarge
HomePantryHerbs & Spices Earth Salt Life Fine Himalayan Pink Salt 2X750G
Previous product
Red Island Extra Virgin Olive Oil 4L $45.49
Back to products
Next product
Nescafe Blend 43 Coffee 650G $25.99

Earth Salt Life Fine Himalayan Pink Salt 2X750G

$6.49

Purchase this product and earn 6 Points

Himalayan Rock Salt is the purest salt available on earth. It is absolutely uncontaminated by any pollutants or toxins. Free from added chemicals, additives and a

Out of stock

Compare
Add to wishlist
SKU: 1372 Category: Herbs & Spices Tags: Condiments, Herbs, Salt, Spices
  • Description
  • Ingredients
  • Disclaimer
Description

Himalayan Rock Salt is the purest salt available on earth. It is absolutely uncontaminated by any pollutants or toxins. Free from added chemicals, additives and anti-caking agents.

Over 250 million years old Himalayan Rock Salt is 100% Natural, unrefined rock salt, hand mined deep within the foothills of the Himalayas.

Pink Himalayan Salt contains over 84 trace elements and minerals in their natural form, including iodine, calcium and iron which are essential for good health.

Ingredients

HIMALAYAN PINK SALT

Disclaimer

Freshease provides general product information such as nutritional information, country of origin and product packaging for your convenience. This information is intended as a guide only, including because products change from time to time. Please read product labels before consuming. For therapeutic goods, always read the label and follow the directions for use on pack. If you require specific information to assist with your purchasing decision, we recommend that you contact the manufacturer via the contact details on the packaging or email us at support@freshease.com.au. Product ratings and reviews are taken from various sources. Freshease does not represent or warrant the accuracy of any statements, claims or opinions made in product ratings and reviews.

Related products

Compare
Close

Mccormick Taco Seasoning 730G

$11.49
McCormickĀ® Taco Seasoning Mix is a zesty blend of authentic Mexican seasonings, including onions & peppers, that's certain to turn ordinary food into a fiesta of
Add to wishlist
Add to cart
Quick view
Compare
Close

Kirkland Signature Crushed Red Pepper 283G

$7.99
Spicy taste Grown in india Pasta and pizza dishes
Add to wishlist
Add to cart
Quick view
Compare
Close

Maggi Classic Rich Gravy Mix 1Kg

$14.49
Maggi Classic Rich Gravy Mix 1kg 2kg ...7.5kg 10kg [Long Expiry Date] Made in NZ
Add to wishlist
Add to cart
Quick view
Compare
Close

Kirkland Signature Chopped Onion 332G

$8.49
Kirkland Signature Chopped Onion is gently dried to preserve its fresh flavour. These California grown chopped onions are excellent in dips, soups, stews and mari
Add to wishlist
Add to cart
Quick view
Compare
Close

Keens Traditional Curry Powder 250G

$7.99
In keeping with the Keen's heritage, Kenn's Traditional Curry Power is blended from only the finest spices.
Add to wishlist
Add to cart
Quick view
Compare
Close

Kirkland Signature Himalayan Pink Salt Grinder With Refill 737G

$12.49
KIRKLAND SIGNATURE HIMALAYAN PINK SALT GRINDER WITH REFILL 737G
Add to wishlist
Add to cart
Quick view
Compare
Close

Mccormick Black Peppercorn Grinder 180G

$9.49
Enjoy freshly ground pepper wherever you need it with this McCormick Black Peppercorn Grinder. This pantry staple adds fresh, bold flavor to almost any dish. Simp
Add to wishlist
Add to cart
Quick view
Compare
Close

Kirkland Signature Himalayan Pink Salt 2.27Kg

$15.99
Himalayan pink salt Fine ground 2.27 kg
Add to wishlist
Add to cart
Quick view

Fresh. Fast. Easy.

HELP & SUPPORT
  • Privacy Policy
  • Delivery Information
  • Returns and Refunds
  • Terms & Conditions
  • Contact Us
  • About Us
  • FAQs
PAYMENT OPTIONS

FOLLOW US
Facebook Instagram
ACN 653 581 456 Ā© 2021 FRESHEASE PTY LTD
All Rights Reserved.
0 Wishlist
Shop
0 items Cart
My account

Shopping cart

close
  • Menu
  • Categories
  • Baby
    • Baby Formula
    • Baby Nappies & Wipes
  • Bakery
    • Bagels
    • Baguettes
    • Biscuits & Crackers
    • Bread
    • Brownies
    • Cakes
    • Cookies
    • Donuts
    • Savoury
    • Sweet Pastry
    • Sweet Rolls
  • Dairy & Fridge
    • Cheese
    • Cream
    • Deli
    • Desserts
    • Dips
    • Eggs
    • Falafel
    • Flavoured Milk
    • Long Life Milk
    • Milk
    • Powder Milk
    • Probiotic Drinks
    • Sauce
    • Spreads
    • Tofu
    • Yoghurt
  • Drinks
    • Energy Drinks
    • Flavoured Drinks
    • Flavoured Milk
    • Iced Teas
    • Juice
    • Milk
    • Probiotic Drinks
    • Soft Drinks
    • Sports Drinks
    • Water
  • Fish & Seafood
    • Seafood
  • Flower
    • Bouquet
  • Freezer
    • Cakes
    • Desserts
    • Frozen Beef
    • Frozen Chicken
    • Frozen Fish & Seafood
    • Frozen Fruits
    • Frozen Meals
    • Frozen Pork
    • Frozen Vegetables
    • Ice Cream
  • Fruits & Veggies
    • Fruits
    • Vegetables
  • Health & Beauty
    • Baby Nappies & Wipes
    • Bath & Shower
    • Cleaning
    • Dental Care
    • Eye Care
    • Face Body & Hands
    • Family Planning
    • Feminine Hygiene Products
    • Hair Treatments
    • Hand Sanitizer
    • Health Instruments
    • Health Supplements
    • Personal Care
    • Protein Powder
    • Protein Supplements
  • Household
    • Air Freshener
    • Batteries
    • Cleaning
    • Dishwashing
    • Insect Killer
    • Kitchen
    • Laundry
    • Tableware
    • Tissue
    • Toilet
  • Gums Lollies & Mints
  • Organic
    • Baby Snakcs
    • Baking
    • Beef
    • Biscuits & Crackers
    • Cereals
    • Cheese
    • Chips
    • Drinks
    • Face Body & Hands
    • Frozen Fruits
    • Fruits
    • Health Food
    • Juice
    • Milk
    • Nuts & Bars
    • Oil
    • Pasta & Pasta Sauce
    • Protein Powder
    • Rice & Grains
    • Sauce
    • Snacks
    • Spreads
    • Sweeteners
    • Tea & Coffee
    • Vegetables
    • Vinegar
    • Waffles
    • Yoghurt
  • Pantry
    • Baking
    • Biscuits & Crackers
    • Canned Fish
    • Canned Fruits
    • Canned Meat
    • Canned Vegetables
    • Cereals
    • Chips
    • Chocolates
    • Condiments
    • Cooking
    • General Items
    • Herbs & Spices
    • Jarred Vegetables
    • Noodles & Soup
    • Nuts & Bars
    • Oil
    • Pasta & Pasta Sauce
    • Pickles
    • Protein Bars
    • Rice & Grains
    • Sauce
    • Snacks
    • Spices
    • Spreads
    • Sweeteners
    • Tea & Coffee
    • Vinegar
    • Wraps
  • Pet
    • Cat Food
    • Dog Food
    • General Items
  • Ready to go meals
  • South East Asian
    • Frozen Meals
    • Herbs & Spices
    • Oil
    • Rice & Grains
    • Tea & Coffee
  • Home
  • Shop
  • SPECIALSNEW
  • Contact Us
  • FAQs

Sign in

close

Lost your password?
Or login with
Facebook
Google
No account yet? Create an Account
Scroll To Top

Sign up
to get free delivery on your first two orders*

*minimum spend $50, cannot be used in conjunction with other offers or coupons.

Will be used in accordance with ourĀ Privacy Policy

We use cookies to improve your experience on our website. By browsing this website, you agree to our use of cookies.
Accept