Free delivery on orders above $100!
  • Become a Member
Free delivery on orders above $100!
Freshease Freshease
Select category
  • Select category
  • Baby
    • Baby Formula
    • Baby Nappies & Wipes
  • Bakery
    • Bagels
    • Baguettes
    • Biscuits & Crackers
    • Bread
    • Brownies
    • Cakes
    • Cookies
    • Donuts
    • Savoury
    • Sweet Pastry
    • Sweet Rolls
  • Christmas
  • Dairy & Fridge
    • Cheese
    • Cream
    • Deli
    • Desserts
    • Dips
    • Eggs
    • Falafel
    • Flavoured Milk
    • Long Life Milk
    • Milk
    • Powder Milk
    • Probiotic Drinks
    • Sauce
    • Spreads
    • Tofu
    • Yoghurt
  • Drinks
    • Energy Drinks
    • Flavoured Drinks
    • Flavoured Milk
    • General Items
    • Iced Teas
    • Juice
    • Milk
    • Probiotic Drinks
    • Soft Drinks
    • Sports Drinks
    • Water
  • Fish & Seafood
    • Seafood
  • Flower
    • Bouquet
  • Freezer
    • Cakes
    • Desserts
    • Frozen Beef
    • Frozen Chicken
    • Frozen Fish
    • Frozen Fish & Seafood
    • Frozen Fruits
    • Frozen Meals
    • Frozen Pork
    • Frozen Vegetables
    • Ice Cream
  • Fruits & Veggies
    • Fruits
    • Vegetables
  • Gums Lollies & Mints
  • Health & Beauty
    • Baby Nappies & Wipes
    • Bath & Shower
    • Cleaning
    • Dental Care
    • Eye Care
    • Face Body & Hands
    • Family Planning
    • Feminine Hygiene Products
    • Hair Treatments
    • Hand Sanitizer
    • Health Instruments
    • Health Supplements
    • Personal Care
    • Protein Powder
    • Protein Supplements
  • Household
    • Air Freshener
    • Batteries
    • Cleaning
    • Dishwashing
    • General Items
    • Insect Killer
    • Kitchen
    • Laundry
    • Tableware
    • Tissue
    • Toilet
  • Meat
    • Beef
    • Chicken
    • Duck
    • Halal Meat
    • Lamb
    • Pork
    • Turkey
  • Organic
    • Baby Snakcs
    • Baking
    • Beef
    • Biscuits & Crackers
    • Cereals
    • Cheese
    • Chips
    • Drinks
    • Face Body & Hands
    • Frozen Fruits
    • Fruits
    • Health Food
    • Juice
    • Milk
    • Nuts & Bars
    • Oil
    • Pasta & Pasta Sauce
    • Protein Powder
    • Rice & Grains
    • Sauce
    • Snacks
    • Spreads
    • Sweeteners
    • Tea & Coffee
    • Vegetables
    • Vinegar
    • Waffles
    • Yoghurt
  • Pantry
    • Baking
    • Biscuits & Crackers
    • Canned Fish
    • Canned Fruits
    • Canned Meat
    • Canned Vegetables
    • Cereals
    • Chips
    • Chocolates
    • Condiments
    • Cooking
    • General Items
    • Herbs & Spices
    • Jarred Vegetables
    • Noodles & Soup
    • Nuts & Bars
    • Oil
    • Pasta & Pasta Sauce
    • Pickles
    • Protein Bars
    • Rice & Grains
    • Sauce
    • Snacks
    • Spices
    • Spreads
    • Stationery
    • Sweeteners
    • Tea & Coffee
    • Vinegar
    • Wraps
  • Pet
    • Cat Food
    • Dog Food
    • General Items
  • Ready to go meals
  • Snacks
    • Chips
  • South East Asian
    • Baking
    • Biscuits & Crackers
    • Cake
    • Condiments
    • Desserts
    • Drinks
    • Frozen Meals
    • Herbs & Spices
    • Oil
    • Pickles
    • Rice & Grains
    • Tea & Coffee
Login / Register
0 Wishlist
0 Compare
0 items / $0.00
Menu
Freshease Freshease
0 items / $0.00
Browse Categories
  • Baby
    • Baby Formula
    • Baby Nappies & Wipes
  • Bakery
    • Bagels
    • Baguettes
    • Biscuits & Crackers
    • Bread
    • Brownies
    • Cakes
    • Cookies
    • Donuts
    • Savoury
    • Sweet Pastry
    • Sweet Rolls
  • Dairy & Fridge
    • Cheese
    • Cream
    • Deli
    • Desserts
    • Dips
    • Eggs
    • Falafel
    • Flavoured Milk
    • Long Life Milk
    • Milk
    • Powder Milk
    • Probiotic Drinks
    • Sauce
    • Spreads
    • Tofu
    • Yoghurt
  • Drinks
    • Energy Drinks
    • Flavoured Drinks
    • Flavoured Milk
    • Iced Teas
    • Juice
    • Milk
    • Probiotic Drinks
    • Soft Drinks
    • Sports Drinks
    • Water
  • Fish & Seafood
    • Seafood
  • Flower
    • Bouquet
  • Freezer
    • Cakes
    • Desserts
    • Frozen Beef
    • Frozen Chicken
    • Frozen Fish & Seafood
    • Frozen Fruits
    • Frozen Meals
    • Frozen Pork
    • Frozen Vegetables
    • Ice Cream
  • Fruits & Veggies
    • Fruits
    • Vegetables
  • Health & Beauty
    • Baby Nappies & Wipes
    • Bath & Shower
    • Cleaning
    • Dental Care
    • Eye Care
    • Face Body & Hands
    • Family Planning
    • Feminine Hygiene Products
    • Hair Treatments
    • Hand Sanitizer
    • Health Instruments
    • Health Supplements
    • Personal Care
    • Protein Powder
    • Protein Supplements
  • Household
    • Air Freshener
    • Batteries
    • Cleaning
    • Dishwashing
    • Insect Killer
    • Kitchen
    • Laundry
    • Tableware
    • Tissue
    • Toilet
  • Gums Lollies & Mints
  • Organic
    • Baby Snakcs
    • Baking
    • Beef
    • Biscuits & Crackers
    • Cereals
    • Cheese
    • Chips
    • Drinks
    • Face Body & Hands
    • Frozen Fruits
    • Fruits
    • Health Food
    • Juice
    • Milk
    • Nuts & Bars
    • Oil
    • Pasta & Pasta Sauce
    • Protein Powder
    • Rice & Grains
    • Sauce
    • Snacks
    • Spreads
    • Sweeteners
    • Tea & Coffee
    • Vegetables
    • Vinegar
    • Waffles
    • Yoghurt
  • Pantry
    • Baking
    • Biscuits & Crackers
    • Canned Fish
    • Canned Fruits
    • Canned Meat
    • Canned Vegetables
    • Cereals
    • Chips
    • Chocolates
    • Condiments
    • Cooking
    • General Items
    • Herbs & Spices
    • Jarred Vegetables
    • Noodles & Soup
    • Nuts & Bars
    • Oil
    • Pasta & Pasta Sauce
    • Pickles
    • Protein Bars
    • Rice & Grains
    • Sauce
    • Snacks
    • Spices
    • Spreads
    • Sweeteners
    • Tea & Coffee
    • Vinegar
    • Wraps
  • Pet
    • Cat Food
    • Dog Food
    • General Items
  • Ready to go meals
  • South East Asian
    • Frozen Meals
    • Herbs & Spices
    • Oil
    • Rice & Grains
    • Tea & Coffee
  • Home
  • Shop
  • SPECIALSNEW
  • Contact Us
  • FAQs
KIRKLANDSIGNATUREMICELLARDAILYFACIALCLEANSINGWIPES180COUNT
Click to enlarge
HomeHealth & BeautyFeminine Hygiene Products Kirkland Signature Micellar Daily Facial Cleansing Wipes 180 Count
Previous product
U By Kotex Ultrathins Regular Pads With Wings 112 Count $35.49
Back to products
Next product
Kirkland Signature Facial Cleansing Wipes 150 Count $12.99

Kirkland Signature Micellar Daily Facial Cleansing Wipes 180 Count

$32.49

Purchase this product and earn 32 Points

Facial Towelettes For All Skin Types
With Micellar Water
Paraben Free

— OR —

Compare
Add to wishlist
SKU: 1764 Category: Feminine Hygiene Products Tags: Cleanser, Face, Health, Wipes
  • Description
  • Ingredients
  • Disclaimer
Description

Facial Towelettes For All Skin Types
With Micellar Water
Paraben Free

Ingredients

micellar-water

Disclaimer

Freshease provides general product information such as nutritional information, country of origin and product packaging for your convenience. This information is intended as a guide only, including because products change from time to time. Please read product labels before consuming. For therapeutic goods, always read the label and follow the directions for use on pack. If you require specific information to assist with your purchasing decision, we recommend that you contact the manufacturer via the contact details on the packaging or email us at support@freshease.com.au. Product ratings and reviews are taken from various sources. Freshease does not represent or warrant the accuracy of any statements, claims or opinions made in product ratings and reviews.

Related products

Compare
Close

Johnson’s Daily Essentials Facial Wipes 150 Count

$32.49
Suitable for normal skin types Suitable for daily use Removes even waterproof mascara Suitable for sensitive eye area Dermatologist tested
Add to wishlist
Add to cart
Quick view
Compare
Close

Maybelline Colossal Mascara Trio Pack

$37.99
The Volum 'Express Colossal Maybelline Three Masks Kit 10Ml guarantees a striking and beautiful look for you who want to have large and completely voluminous lash
Add to wishlist
Add to cart
Quick view
Compare
Close

Elizabeth Arden Millenium Day & Night Hydration 3 Pack

$96.49
Look young like never before with the Millenium Night Renewal Cream. With this Elizabeth Arden night cream, the fine lines on your face will be smoothened. Being
Add to wishlist
Add to cart
Quick view
Compare
Close

Salts & Co Pure Magnesium Bath Flakes 3.75 Kg

$19.49
Offers a highly effective, yet muscle calming, means of absorbing magnesium nutrients. Soaking in magnesium salts has been shown to markedly improve skin hydratio
Add to wishlist
Add to cart
Quick view
Compare
Close

Deep Heat Back Patches 4 X 2 Pack

$31.49
Deep Heat Back Patches provide up to 16 hours* of targeted, sustained, long lasting and soothing temporary pain relief of Back Pain, Muscular Aches and Pain, Join
Add to wishlist
Add to cart
Quick view
Compare
Close

U By Kotex Regular Slim Tampons 160 Count

$35.49
U by KotexĀ® Tampons give you all the protection you need in a slim and comfortable design. Their slender tip means it's easier to use while offering you superi
Add to wishlist
Add to cart
Quick view
Compare
Close

U By Kotex Ultrathins Regular Pads With Wings 112 Count

$35.49
112 Ultrathin pads. 8 x packs of 14 regular wing ultrathins. 90418 3D Rapid Dry Core
Add to wishlist
Add to cart
Quick view
Compare
Close

Poise Regular Liners 78 counts

$15.99
Add to wishlist
Add to cart
Quick view

Fresh. Fast. Easy.

HELP & SUPPORT
  • Privacy Policy
  • Delivery Information
  • Returns and Refunds
  • Terms & Conditions
  • Contact Us
  • About Us
  • FAQs
PAYMENT OPTIONS

FOLLOW US
Facebook Instagram
ACN 653 581 456 Ā© 2021 FRESHEASE PTY LTD
All Rights Reserved.
0 Wishlist
Shop
0 items Cart
My account

Shopping cart

close
  • Menu
  • Categories
  • Baby
    • Baby Formula
    • Baby Nappies & Wipes
  • Bakery
    • Bagels
    • Baguettes
    • Biscuits & Crackers
    • Bread
    • Brownies
    • Cakes
    • Cookies
    • Donuts
    • Savoury
    • Sweet Pastry
    • Sweet Rolls
  • Dairy & Fridge
    • Cheese
    • Cream
    • Deli
    • Desserts
    • Dips
    • Eggs
    • Falafel
    • Flavoured Milk
    • Long Life Milk
    • Milk
    • Powder Milk
    • Probiotic Drinks
    • Sauce
    • Spreads
    • Tofu
    • Yoghurt
  • Drinks
    • Energy Drinks
    • Flavoured Drinks
    • Flavoured Milk
    • Iced Teas
    • Juice
    • Milk
    • Probiotic Drinks
    • Soft Drinks
    • Sports Drinks
    • Water
  • Fish & Seafood
    • Seafood
  • Flower
    • Bouquet
  • Freezer
    • Cakes
    • Desserts
    • Frozen Beef
    • Frozen Chicken
    • Frozen Fish & Seafood
    • Frozen Fruits
    • Frozen Meals
    • Frozen Pork
    • Frozen Vegetables
    • Ice Cream
  • Fruits & Veggies
    • Fruits
    • Vegetables
  • Health & Beauty
    • Baby Nappies & Wipes
    • Bath & Shower
    • Cleaning
    • Dental Care
    • Eye Care
    • Face Body & Hands
    • Family Planning
    • Feminine Hygiene Products
    • Hair Treatments
    • Hand Sanitizer
    • Health Instruments
    • Health Supplements
    • Personal Care
    • Protein Powder
    • Protein Supplements
  • Household
    • Air Freshener
    • Batteries
    • Cleaning
    • Dishwashing
    • Insect Killer
    • Kitchen
    • Laundry
    • Tableware
    • Tissue
    • Toilet
  • Gums Lollies & Mints
  • Organic
    • Baby Snakcs
    • Baking
    • Beef
    • Biscuits & Crackers
    • Cereals
    • Cheese
    • Chips
    • Drinks
    • Face Body & Hands
    • Frozen Fruits
    • Fruits
    • Health Food
    • Juice
    • Milk
    • Nuts & Bars
    • Oil
    • Pasta & Pasta Sauce
    • Protein Powder
    • Rice & Grains
    • Sauce
    • Snacks
    • Spreads
    • Sweeteners
    • Tea & Coffee
    • Vegetables
    • Vinegar
    • Waffles
    • Yoghurt
  • Pantry
    • Baking
    • Biscuits & Crackers
    • Canned Fish
    • Canned Fruits
    • Canned Meat
    • Canned Vegetables
    • Cereals
    • Chips
    • Chocolates
    • Condiments
    • Cooking
    • General Items
    • Herbs & Spices
    • Jarred Vegetables
    • Noodles & Soup
    • Nuts & Bars
    • Oil
    • Pasta & Pasta Sauce
    • Pickles
    • Protein Bars
    • Rice & Grains
    • Sauce
    • Snacks
    • Spices
    • Spreads
    • Sweeteners
    • Tea & Coffee
    • Vinegar
    • Wraps
  • Pet
    • Cat Food
    • Dog Food
    • General Items
  • Ready to go meals
  • South East Asian
    • Frozen Meals
    • Herbs & Spices
    • Oil
    • Rice & Grains
    • Tea & Coffee
  • Home
  • Shop
  • SPECIALSNEW
  • Contact Us
  • FAQs

Sign in

close

Lost your password?
Or login with
Facebook
Google
No account yet? Create an Account
Scroll To Top

Sign up
to get free delivery on your first two orders*

*minimum spend $50, cannot be used in conjunction with other offers or coupons.

Will be used in accordance with ourĀ Privacy Policy

We use cookies to improve your experience on our website. By browsing this website, you agree to our use of cookies.
Accept